PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_023012-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 334aa    MW: 37161.9 Da    PI: 6.6878
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_023012-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l++++  +G g+W++++r  g+ R++k+c++rw +yl
    NNU_023012-RA 14 RGLWSPEEDEKLINYISTHGHGCWSSVPRLAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding51.72.1e-1667109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++++eE  l++++++ lG++ W+ Ia++++ gRt++++k++w+
    NNU_023012-RA  67 RGSFSPEEASLIIQLHRILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                      899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-26664IPR009057Homeodomain-like
PROSITE profilePS5129418.34961IPR017930Myb domain
SuperFamilySSF466891.24E-2912108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002494.0E-161461IPR001005SANT/Myb domain
CDDcd001672.66E-121761No hitNo description
PROSITE profilePS5129425.73262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2565117IPR009057Homeodomain-like
SMARTSM007172.3E-1666114IPR001005SANT/Myb domain
PfamPF002495.1E-1567110IPR001005SANT/Myb domain
CDDcd001671.72E-1269109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRHSCCSKQ KVRRGLWSPE EDEKLINYIS THGHGCWSSV PRLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SPEEASLIIQ LHRILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLIMSS  120
DSVSDLTTLP DVCNPVGFGE GLLTVKANPN IIIGDQQQHM PQGINHDDFE PDMIDQDVNY  180
WVSASPAASL PLQSETNSVN PIWRSDYDQT NHHHGHQSDS PKDLNDMKFT TTVYDELLLG  240
SSVMPKLCEI LDMDKCGMTS SSASHEGDPA SNMIPPCTQL QSYPYNLRHM ATNPIGCTDA  300
TMPALSFSSS SLSSSLSCGA MNPNLPPNWV QLLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010242247.10.0PREDICTED: transcription factor MYB24-like
TrEMBLA0A061GC446e-95A0A061GC44_THECC; MYB7
STRINGPOPTR_0001s20370.11e-91(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-75myb domain protein 26